Ssm 으스스한 독소

Ssm spooky toxin
으스스한 독소
5X0S.png
으스스한 독소의 3D 구조
식별자
유기체스콜로펜드라하위스파이프 무틸란스
기호SsTx
PDB5X0S

스푸키독소(SsTx)는 작은 펩타이드 신경독소다. 황금머리 지네로 알려진 중국 붉은머리 지네(Scolopendra subspinipes mutilans)의 에서 발견된다. It is originally composed of 76 amino acids (sequence MEKKIIFLVFLVALLALPGFISTEVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG, disulfide bonds Cys43-Cys69, Cys47-Cys71), with a molecular weight of 6017.5 Daltons, but loses the first 23 residues and becomes 53 residues long (sequence EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG, disulFide bonds Cys20-Cys46, Cys24-Cys48). SsTx는 현재 Scolopendra subspinipes mutilans만의 독특한 것으로 생각된다.

KCNQ 채널을 차단함으로써(칼륨이 세포로 들어오고 나가는 것을 막음) SsTx는 심혈관계, 호흡기, 근육계, 신경계를 교란시킨다; 뱀의 정맥은 일반적으로 순환계나 신경계에만 영향을 미치고, 거미, 전갈류, 달팽이의 독은 전형적으로 신경계만을 대상으로 한다. 이것은 황금머리 지네가 그들의 크기의 15배까지 더 큰 먹이를 목표로 할 수 있게 해준다.[1]

적용들

스콜로펜드라 서브스피니페스 돌연변이의 독은 이미 아시아 각국에서 전통의학으로 널리 사용되고 있다.[2] 주장된 약용으로는 항균, 항균, 항암제 등이 있다.[3][4][5]

참고 항목

참조

  1. ^ Luo L, Li B, Wang S, Wu F, Wang X, Liang P, et al. (February 2018). "Centipedes subdue giant prey by blocking KCNQ channels". Proceedings of the National Academy of Sciences of the United States of America. 115 (7): 1646–1651. doi:10.1073/pnas.1714760115. PMC 5816164. PMID 29358396.
  2. ^ Pemberton RW (June 1999). "Insects and other arthropods used as drugs in Korean traditional medicine". Journal of Ethnopharmacology. 65 (3): 207–16. doi:10.1016/S0378-8741(98)00209-8. PMID 10404418.
  3. ^ Yoo WG, Lee JH, Shin Y, Shim JY, Jung M, Kang BC, et al. (June 2014). "Antimicrobial peptides in the centipede Scolopendra subspinipes mutilans". Functional & Integrative Genomics. 14 (2): 275–83. doi:10.1007/s10142-014-0366-3. PMID 24652097. S2CID 18793966.
  4. ^ Wenhua R, Shuangquan Z, Daxiang S, Kaiya Z, Guang Y (April 2006). "Induction, purification and characterization of an antibacterial peptide scolopendrin I from the venom of centipede Scolopendra subspinipes mutilans". Indian Journal of Biochemistry & Biophysics. 43 (2): 88–93. PMID 16955756.
  5. ^ Lee JH, Kim IW, Kim SH, Kim MA, Yun EY, Nam SH, et al. (August 2015). "Anticancer Activity of the Antimicrobial Peptide Scolopendrasin VII Derived from the Centipede, Scolopendra subspinipes mutilans". Journal of Microbiology and Biotechnology. 25 (8): 1275–80. doi:10.4014/jmb.1503.03091. PMID 25907065.