레피루딘
Lepirudin | |
| 임상자료 | |
|---|---|
| 상명 | 리플루던 |
| AHFS/Drugs.com | 모노그래프 |
| 경로: 행정 | SQ 또는 IV |
| ATC 코드 | |
| 법적현황 | |
| 법적현황 |
|
| 약동학 데이터 | |
| 생체이용가능성 | 100 |
| 제거 반감기 | ~1.3시간 |
| 배설 | 레날 |
| 식별자 | |
| |
| CAS 번호 | |
| IUPHAR/BPS | |
| 드러그뱅크 | |
| 켐스파이더 |
|
| 유니 | |
| 케그 | |
| 체비 | |
| 켐벨 | |
| CompTox 대시보드 (EPA) | |
| 화학 및 물리적 데이터 | |
| 공식 | C288H448N80O110S6 |
| 어금질량 | 6983.56 g·190−1 |
  (이게 뭐야?) (iii) | |
레피루딘은 직접 트롬빈 억제제 역할을 하는 항응고제다.
브랜드 이름: Refludan, 일반:레피루딘 RDNA 주사용.
레피루딘은 효모세포에서 추출한 히루딘[1] 재조합물이다.Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the63번 위치의 티로신에서 황산염 그룹의 부재
레피루딘은 헤파린 유도 혈소판감소증 때문에 헤파린(분해되지 않았거나 낮은 분자체중량)이 억제되었을 때 항응고제로 사용될 수 있다.
시장철회
바이엘은 2012년 5월 31일 레피루딘(Refludan) 생산을 중단했다고 발표했다.발표 당시 회사 측은 도매상들의 공급이 2013년 중반쯤 고갈될 것으로 예상했다.[2]
참조
- ^ Arman T. Askari; A. Michael Lincoff (October 2009). Antithrombotic Drug Therapy in Cardiovascular Disease. Springer. pp. 440–. ISBN 978-1-60327-234-6. Retrieved 30 October 2010.
- ^ "Discontinued Drug Bulletin: Lepirudin Injection". www.ashp.org. Archived from the original on 2014-07-23.
외부 링크
- 질병 데이터베이스(DDB): 30082
- Smythe M, Stephens J, Koerber J, Mattson J (2005). "A comparison of lepirudin and argatroban outcomes". Clin Appl Thromb Hemost. 11 (4): 371–4. doi:10.1177/107602960501100403. PMID 16244762.
- Tardy, B; Lecompte, T; Boelhen, F; Tardy-Poncet, B; Elalamy, I; Morange, P; Gruel, Y; Wolf, M; François, D (2006). "Predictive factors for thrombosis and major bleeding in an observational study in 181 patients with heparin-induced thrombocytopenia treated with lepirudin". Blood. 108 (5): 1492–6. doi:10.1182/blood-2006-02-001057. PMID 16690967.
- Lubenow N, Eichler P, Lietz T, Greinacher A (2005). "Lepirudin in patients with heparin-induced thrombocytopenia - results of the third prospective study (HAT-3) and a combined analysis of HAT-1, HAT-2, and HAT-3". J Thromb Haemost. 3 (11): 2428–36. doi:10.1111/j.1538-7836.2005.01623.x. PMID 16241940.
