APOL2

APOL2
식별자
에일리어스	APOL2, APOL-II, APOL3, 아폴리포단백 L2
외부 ID	OMIM : 607252 MGI : 2444921 HomoloGene : 12785 GenCard : APOL2
유전자 위치(인간)
크르.	22번 염색체(인간)
끝.	36,239,954 bp
유전자 위치(마우스)
크르.	15번 염색체(쥐)
끝.	77,641,194 bp
RNA발현패턴
	상단 표시 위치:
	담낭; ; 뇌하수체 전엽; ; 내장글로부페리더스; ; 피; ; 소뇌 반구; ; 단구; ; 경골 신경; ; 평활근 조직; ; 좌폐 상엽; ; 림프절;
	상단 표시 위치:
	골수; ; 안면 운동핵; ; 흑색 실체; ; 비장; ; 상전두회; ; 척수 전각; ; 대퇴골체; ; 소뇌 피질; ; 해마의 고유 영역 I; ; 내측 전정핵;
	추가 참조 표현식 데이터
	; ;
	추가 참조 표현식 데이터
유전자 존재론
분자 함수	신호수용체결합; 지질 결합; 고밀도 리포단백질 입자 결합;
셀룰러 컴포넌트	세포질; 세포외 영역; 소포체막; 막;
생물학적 과정	다세포 생물 발달; 리포단백질대사과정; 지질수송; 콜레스테롤 대사 과정; 급성상 응답; 여성 임신과 관련된 모성 과정; 지질대사; 운송;
	출처:아미고 / QuickGO
맞춤법
	23780
	239552
	ENSG00000128335
	ENSMUSG000056656
	Q9BQE5
	없음
	NM_030882; NM_145637
	NM_001081970; NM_001357895; NM_001357896
	NP_112092; NP_663612
	없음
	위키데이터
인간 보기/편집	마우스 표시/편집

아폴리포단백질 L2는 사람에게서 APOL2 ^[5]^[6]^[7]유전자에 의해 암호화되는 단백질이다.

이 유전자는 아폴리포단백질 L 유전자군의 일종으로 이 과의 단백질은 지질결합단백질이다.이 유전자는 37.1 kDa 단백질을 암호화하고 단백질 배열은 337bp를 포함합니다.이 단백질의 국재성은 주로 세포질, 핵질에서 발견되며 핵체에서도 ^[8]나타난다.이 유전자의 관여는 지질 이동과 지방질의 세포소기관 결합에 영향을 미칠 수 있다.이 ^[7]유전자에 대해 동일한 단백질을 코드하는 두 개의 전사 변형이 발견되었다.

단백질 배열

>sp Q9BQE5 1-337

MNPESSIEDYLFQDVSRENLLLLTDEAWNGFVAAELPRDEADELKALNKLA

SHMVMKKNRHDKDQQHRQWFLKEFRELEDHIRKLRAEVHRGTIANVS

NSVGTSGLLLAPFLLLDTGMGLGAAAAVAGITCSVVNKLRARAQ

ARNLDQSGTNBACKVMKEFGGNTPNVLVDNWYQTQGIGRNIRANPQLGAYA

ppphiigrisaeGGEQVPAQAMSRGTMIVGAATGILLDVV슬레이즈클렐

각세세엘크랙랙플랫키헴플랫큐

상호 작용

APOL2는 다음과 상호작용하는 것으로 나타났습니다.

IFN-time,^[9]

CD81,^[10]

TNF-α,^[11]

BCL-2,^[12]

스플라이스 변형

ApoL2에는 5개의 스플라이스 ^[13]변형이 있습니다.

APOL2-001

이 스크립트에는 6개의 exon, 12개의 도메인과 기능에 주석이 붙어 있으며, 263개의 변형은 이와 관련이 있으며 35개의 oligo 프로브에 매핑됩니다.

APOL2-002

이 기록은 5개의 엑손, 12개의 도메인과 특징에 주석을 달았고 263개의 변이가 이 유전자와 관련이 있으며 37개의 올리고 프로브에 매핑됩니다.

APOL2-006

이 기록물은 6개의 엑손이 있고, 3개의 도메인과 특징에 주석이 달렸고, 62개의 변이가 이 유전자와 관련이 있으며, 20개의 올리고 프로브에 매핑됩니다.

APOL2-008

이 기록은 6개의 엑손, 12개의 도메인과 특징에 주석을 달았고 331개의 변이가 이 유전자와 관련이 있으며 32개의 올리고 프로브에 매핑됩니다.

APOL2-009

이 기록은 5개의 엑손이 있고 4개의 도메인과 특징이 주석을 달았으며 104개의 변이가 이 유전자와 관련이 있으며 13개의 올리고 프로브에 매핑됩니다.

ApoL2의 기능

급성 염증 반응
콜레스테롤 대사^[16] 과정
지질대사과정^[12]
여성^[17] 임신에 관여하는 모성 과정
지질결합^[18]
시그널링 리셉터^[18] 바인딩
에이징

레퍼런스

^ ^a ^b ^c GRCh38: 앙상블 릴리즈 89: ENSG00000128335 - 앙상블, 2017년 5월
^ ^a ^b ^c GRCm38: 앙상블 릴리즈 89: ENSMUSG000056656 - 앙상블, 2017년 5월
^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
^ Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al. (Dec 1999). "The DNA sequence of human chromosome 22". Nature. 402 (6761): 489–95. doi:10.1038/990031. PMID 10591208.
^ Page NM, Butlin DJ, Lomthaisong K, Lowry PJ (May 2001). "The human apolipoprotein L gene cluster: identification, classification, and sites of distribution". Genomics. 74 (1): 71–8. doi:10.1006/geno.2001.6534. PMID 11374903.
^ ^a ^b "Entrez Gene: APOL2 apolipoprotein L, 2".
^ "The Human Protein atlas Gene: APOL2 apolipoprotein L, 2".
^ Liao W, Goh FY, Betts RJ, Kemeny DM, Tam J, Bay BH, Wong WS (February 2011). "A novel anti-apoptotic role for apolipoprotein L2 in IFN-gamma-induced cytotoxicity in human bronchial epithelial cells". J Cell Physiol. 226 (2): 397–406. doi:10.1002/jcp.22345. PMID 20665705. S2CID 27845807.
^ Bruening J, Lasswitz L, Banse P, Kahl S, Marinach C, Vondran FW, Kaderali L, Silvie O, Pietschmann T, Meissner F, Gerold G (July 2018). "Hepatitis C virus enters liver cells using the CD81 receptor complex proteins calpain-5 and CBLB". PLOS Pathogens. 14 (7): 55–67. doi:10.1371/journal.ppat.1007111. PMC 6053247. PMID 30024968.
^ Smith EE, Malik HS (May 2009). "The apolipoprotein L family of programmed cell death and immunity genes rapidly evolved in primates at discrete sites of host-pathogen interactions". Genome Res. 19 (5): 850–8. doi:10.1101/gr.085647.108. PMC 2675973. PMID 19299565.
^ ^a ^b Liu Z, Lu H, Jiang Z, Pastuszyn A, Hu CA (January 2005). "Apolipoprotein l6, a novel proapoptotic Bcl-2 homology 3-only protein, induces mitochondria-mediated apoptosis in cancer cells". Mol Cancer Res. 3 (1): 21–31. PMID 15671246.
^ "The Human Protein atlas Gene: APOL2 apolipoprotein L, 2".
^ Rao SK, Pavicevic Z, Du Z, Kim JG, Fan M, Jiao Y, Rosebush M, Samant S, Gu W, Pfeffer LM, Nosrat CA (October 2010). "Pro-inflammatory genes as biomarkers and therapeutic targets in oral squamous cell carcinoma". J Biol Chem. 285 (42): 32512–21. doi:10.1074/jbc.M110.150490. PMC 2952253. PMID 20702412.
^ Liu Z, Lu H, Jiang Z, Pastuszyn A, Hu CA (October 2013). "Mitochondrial proteomic analysis of human host cells infected with H3N2 swine influenza virus". J Proteomics. 8 (91): 136–50. doi:10.1016/j.jprot.2013.06.037. PMID 23856606.
^ Wang K, Edmondson AC, Li M, Gao F, Qasim AN, Devaney JM, Burnett MS, Waterworth DM, Mooser V, Grant SF, Epstein SE, Reilly MP, Hakonarson H, Rader DJ (July 2011). "Pathway-Wide Association Study Implicates Multiple Sterol Transport and Metabolism Genes in HDL Cholesterol Regulation". Frontiers in Genetics. 2 (4): 41. doi:10.3389/fgene.2011.00041. PMC 3268595. PMID 22303337.
^ Brosens JJ, Hodgetts A, Feroze-Zaidi F, Sherwin JR, Fusi L, Salker MS, Higham J, Rose GL, Kajihara T, Young SL, Lessey BA, Henriet P, Langford PR, Fazleabas AT (April 2010). "Proteomic analysis of endometrium from fertile and infertile patients suggests a role for apolipoprotein A-I in embryo implantation failure and endometriosis". MHR: Basic Science of Reproductive Medicine. 16 (4): 273–285. doi:10.1093/molehr/gap108. PMC 2834406. PMID 20008415.
^ ^a ^b "Nextprot Gene: APOL2 apolipoprotein L, 2".
^ Luo, Audrey; Jung, Jeesun; Longley, Martha; Rosoff, Daniel B.; Charlet, Katrin; Muench, Christine; Lee, Jisoo; Hodgkinson, Colin A.; Goldman, David; Horvath, Steve; Kaminsky, Zachary A.; Lohoff, Falk W. (2020). "Epigenetic aging is accelerated in alcohol use disorder and regulated by genetic variation in APOL2". Neuropsychopharmacology. 45 (2): 327–336. doi:10.1038/s41386-019-0500-y. PMC 6901591. PMID 31466081.

외부 링크

UCSC Genome Browser의 인간 APOL2 게놈 위치 및 APOL2 유전자 세부 정보 페이지.
UCSC Genome Browser의 인간 APOL3 게놈 위치 및 APOL3 유전자 세부 정보 페이지.

추가 정보

McGhee KA, Morris DW, Schwaiger S (2005). "Investigation of the apolipoprotein-L (APOL) gene family and schizophrenia using a novel DNA pooling strategy for public database SNPs". Schizophr. Res. 76 (2–3): 231–8. doi:10.1016/j.schres.2005.01.006. PMID 15949655. S2CID 5639495.
Gerhard DS, Wagner L, Feingold EA (2004). "The Status, Quality, and Expansion of the NIH Full-Length cDNA Project: The Mammalian Gene Collection (MGC)". Genome Res. 14 (10B): 2121–7. doi:10.1101/gr.2596504. PMC 528928. PMID 15489334.
Ota T, Suzuki Y, Nishikawa T (2004). "Complete sequencing and characterization of 21,243 full-length human cDNAs". Nat. Genet. 36 (1): 40–5. doi:10.1038/ng1285. PMID 14702039.
Strausberg RL, Feingold EA, Grouse LH (2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci. U.S.A. 99 (26): 16899–903. doi:10.1073/pnas.242603899. PMC 139241. PMID 12477932.
Monajemi H, Fontijn RD, Pannekoek H, Horrevoets AJ (2002). "The apolipoprotein L gene cluster has emerged recently in evolution and is expressed in human vascular tissue". Genomics. 79 (4): 539–46. doi:10.1006/geno.2002.6729. PMID 11944986.
Duchateau PN, Pullinger CR, Cho MH (2001). "Apolipoprotein L gene family: tissue-specific expression, splicing, promoter regions; discovery of a new gene". J. Lipid Res. 42 (4): 620–30. doi:10.1016/S0022-2275(20)31171-8. PMID 11290834.
Adams MD, Kerlavage AR, Fleischmann RD (1995). "Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence" (PDF). Nature. 377 (6547 Suppl): 3–174. PMID 7566098.

인간 염색체 22번 유전자에 대한 이 기사는 뭉툭한 것이다.위키피디아를 확장함으로써 위키피디아를 도울 수 있습니다.

[refGRCh38Ensembl-1] GRCh38: 앙상블 릴리즈 89: ENSG00000128335 - 앙상블, 2017년 5월

[refGRCm38Ensembl-2] GRCm38: 앙상블 릴리즈 89: ENSMUSG000056656 - 앙상블, 2017년 5월

[3] "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.

[4] "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.

[pmid10591208-5] Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al. (Dec 1999). "The DNA sequence of human chromosome 22". Nature. 402 (6761): 489–95. doi:10.1038/990031. PMID 10591208.

[pmid11374903-6] Page NM, Butlin DJ, Lomthaisong K, Lowry PJ (May 2001). "The human apolipoprotein L gene cluster: identification, classification, and sites of distribution". Genomics. 74 (1): 71–8. doi:10.1006/geno.2001.6534. PMID 11374903.

[entrez-7] "Entrez Gene: APOL2 apolipoprotein L, 2".

[Protein_Location-8] "The Human Protein atlas Gene: APOL2 apolipoprotein L, 2".

[pmid20665705-9] Liao W, Goh FY, Betts RJ, Kemeny DM, Tam J, Bay BH, Wong WS (February 2011). "A novel anti-apoptotic role for apolipoprotein L2 in IFN-gamma-induced cytotoxicity in human bronchial epithelial cells". J Cell Physiol. 226 (2): 397–406. doi:10.1002/jcp.22345. PMID 20665705. S2CID 27845807.

[pmid30024968-10] Bruening J, Lasswitz L, Banse P, Kahl S, Marinach C, Vondran FW, Kaderali L, Silvie O, Pietschmann T, Meissner F, Gerold G (July 2018). "Hepatitis C virus enters liver cells using the CD81 receptor complex proteins calpain-5 and CBLB". PLOS Pathogens. 14 (7): 55–67. doi:10.1371/journal.ppat.1007111. PMC 6053247. PMID 30024968.

[pmid19299565-11] Smith EE, Malik HS (May 2009). "The apolipoprotein L family of programmed cell death and immunity genes rapidly evolved in primates at discrete sites of host-pathogen interactions". Genome Res. 19 (5): 850–8. doi:10.1101/gr.085647.108. PMC 2675973. PMID 19299565.

[pmid15671246-12] Liu Z, Lu H, Jiang Z, Pastuszyn A, Hu CA (January 2005). "Apolipoprotein l6, a novel proapoptotic Bcl-2 homology 3-only protein, induces mitochondria-mediated apoptosis in cancer cells". Mol Cancer Res. 3 (1): 21–31. PMID 15671246.

[Protein_Information-13] "The Human Protein atlas Gene: APOL2 apolipoprotein L, 2".

[pmid20702412-14] Rao SK, Pavicevic Z, Du Z, Kim JG, Fan M, Jiao Y, Rosebush M, Samant S, Gu W, Pfeffer LM, Nosrat CA (October 2010). "Pro-inflammatory genes as biomarkers and therapeutic targets in oral squamous cell carcinoma". J Biol Chem. 285 (42): 32512–21. doi:10.1074/jbc.M110.150490. PMC 2952253. PMID 20702412.

[pmid23856606-15] Liu Z, Lu H, Jiang Z, Pastuszyn A, Hu CA (October 2013). "Mitochondrial proteomic analysis of human host cells infected with H3N2 swine influenza virus". J Proteomics. 8 (91): 136–50. doi:10.1016/j.jprot.2013.06.037. PMID 23856606.

[pmid22303337-16] Wang K, Edmondson AC, Li M, Gao F, Qasim AN, Devaney JM, Burnett MS, Waterworth DM, Mooser V, Grant SF, Epstein SE, Reilly MP, Hakonarson H, Rader DJ (July 2011). "Pathway-Wide Association Study Implicates Multiple Sterol Transport and Metabolism Genes in HDL Cholesterol Regulation". Frontiers in Genetics. 2 (4): 41. doi:10.3389/fgene.2011.00041. PMC 3268595. PMID 22303337.

[pmid20008415-17] Brosens JJ, Hodgetts A, Feroze-Zaidi F, Sherwin JR, Fusi L, Salker MS, Higham J, Rose GL, Kajihara T, Young SL, Lessey BA, Henriet P, Langford PR, Fazleabas AT (April 2010). "Proteomic analysis of endometrium from fertile and infertile patients suggests a role for apolipoprotein A-I in embryo implantation failure and endometriosis". MHR: Basic Science of Reproductive Medicine. 16 (4): 273–285. doi:10.1093/molehr/gap108. PMC 2834406. PMID 20008415.

[Go_Biological_Process-18] "Nextprot Gene: APOL2 apolipoprotein L, 2".

[19] Luo, Audrey; Jung, Jeesun; Longley, Martha; Rosoff, Daniel B.; Charlet, Katrin; Muench, Christine; Lee, Jisoo; Hodgkinson, Colin A.; Goldman, David; Horvath, Steve; Kaminsky, Zachary A.; Lohoff, Falk W. (2020). "Epigenetic aging is accelerated in alcohol use disorder and regulated by genetic variation in APOL2". Neuropsychopharmacology. 45 (2): 327–336. doi:10.1038/s41386-019-0500-y. PMC 6901591. PMID 31466081.

[1]

[2]

[3]

[4]

[5]

[6]

[7]

[8]

[9]

[10]

[11]

[12]

[13]

[16]

[17]

[18]

Search